PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04514.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 413aa    MW: 44049.1 Da    PI: 8.2462
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04514.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-17123170148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT+eEd +l+     +G+g+W+t++r+ g++R++k+c++r+ +yl
  Zmw_sc04514.1.g00040.1.am.mk 123 KGPWTPEEDAKLLAFTSTHGTGNWTTVPRRAGLKRCGKSCRLRYTNYL 170
                                   79********************************************97 PP

2Myb_DNA-binding538.2e-17178219346
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Zmw_sc04514.1.g00040.1.am.mk 178 NFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 219
                                   89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-23114174IPR009057Homeodomain-like
PROSITE profilePS5129416.874118170IPR017930Myb domain
SuperFamilySSF466896.74E-30120217IPR009057Homeodomain-like
SMARTSM007172.8E-14122172IPR001005SANT/Myb domain
PfamPF002496.9E-15123170IPR001005SANT/Myb domain
CDDcd001676.25E-11125170No hitNo description
PROSITE profilePS5129425.003171225IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-23175225IPR009057Homeodomain-like
SMARTSM007173.5E-15175223IPR001005SANT/Myb domain
CDDcd001673.16E-12178221No hitNo description
PfamPF002495.3E-15178219IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MAVPILEITA FRIPPLGSHP FNVVIVVAVA LLGVARGAVA VLNRGRGGHA FVARLHLPQH  60
VVTVRAFFLL LPLLIVGAAS ICTVTTTTTF PQRCGGLTGQ ARRRGRSPSM GRPPCCDKAS  120
VKKGPWTPEE DAKLLAFTST HGTGNWTTVP RRAGLKRCGK SCRLRYTNYL RPNLKHENFT  180
QEEEELIVTL HAMLGSRWSL IANQLPGRTD NDVKNYWNTK LSKKLRQRGI DPITHRPIAD  240
LMHSIGALAI RPPQPPQHPN TSAYLLPASP AALPLVHDVA FHAAGLLPPH QQQQQQVLVD  300
VDAPESSHHG QIKWSDFLAD DATAEAQQVL GQQYHHEAVA PAGGVQASGS TAAGGGHNAC  360
TDYNAGGGGG GDDGAAAFID AILDCDKETG VDQLIAELLA DPAYYAGSSS SPD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-291232257108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150470.11e-146DNA binding protein
TrEMBLB6TQ241e-146B6TQ24_MAIZE; DNA binding protein
STRINGGRMZM2G308034_P011e-145(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439